PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family NF-YB
Protein Properties Length: 161aa    MW: 17397.3 Da    PI: 7.4999
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015270genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.62.9e-5625119195
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                  vreqdr+lPian+srimkk+lPan+ki+kdak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfedy++plk+yl++yre ++
  DCAR_015270  25 VREQDRYLPIANISRIMKKALPANGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKAYLARYREGDT 119
                  69*****************************************************************************************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.1E-5420137IPR009072Histone-fold
SuperFamilySSF471131.1E-3928135IPR009072Histone-fold
PfamPF008081.5E-283195IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.6E-205977No hitNo description
PROSITE patternPS0068506278IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-207896No hitNo description
PRINTSPR006151.6E-2097115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MADGSASPAG GSHESGGDQS PRSNVREQDR YLPIANISRI MKKALPANGK IAKDAKDTVQ  60
ECVSEFISFI TSEASDKCQK EKRKTINGDD LLWAMATLGF EDYIDPLKAY LARYREGDTK  120
GSARGEGSAK KDQVGAQISN QQYAHQGSYS QGMSYVNSHI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A6e-4824116294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B6e-4824116294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A6e-4824116193NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1201047e-61AB120104.1 Daucus carota DcLEC1d mRNA for HAP3-like CCAAT box binding protein, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278716.11e-95PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
RefseqXP_003633465.11e-95PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
RefseqXP_010658455.11e-95PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
SwissprotQ8VYK41e-76NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLD7TMF32e-97D7TMF3_VITVI; Putative uncharacterized protein
STRINGVIT_13s0019g03600.t015e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.36e-78nuclear factor Y, subunit B8